PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_22131-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NAC
Protein Properties Length: 332aa    MW: 36426.3 Da    PI: 6.621
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_22131-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.62.1e-5231311128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                      lppGfrF+Ptd+elv++yLk++v++ k+el evi+ +d+yk+ePw+Lp k  + +++ ew+fF++rd+ky++g+r+nrat++gyWkatgkd++v
  TRIUR3_22131-P1   3 LPPGFRFRPTDDELVSYYLKRRVDNLKIEL-EVIPVIDLYKCEPWELPeKsFLPKRDLEWFFFVPRDRKYPNGSRTNRATTTGYWKATGKDRKV 95 
                      79****************************.99**************95334445667************************************ PP

              NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       + +g++ g++ktLvfykgrap ge+tdWvmheyrl
  TRIUR3_22131-P1  96 SCDGGAVCGVRKTLVFYKGRAPGGERTDWVMHEYRL 131
                      **********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.4E-592153IPR003441NAC domain
PROSITE profilePS5100556.8483154IPR003441NAC domain
PfamPF023654.3E-284131IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008283Biological Processcell proliferation
GO:0071365Biological Processcellular response to auxin stimulus
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MTLPPGFRFR PTDDELVSYY LKRRVDNLKI ELEVIPVIDL YKCEPWELPE KSFLPKRDLE  60
WFFFVPRDRK YPNGSRTNRA TTTGYWKATG KDRKVSCDGG AVCGVRKTLV FYKGRAPGGE  120
RTDWVMHEYR LCQDLLHGAS NFIGAYALCR VIKRTEAGLL HGDAAAKARP GHRQMSKVGS  180
SSSLVTTDQQ LGSLTPSPPR LDIVGNAFQL HSSPSPLYGG GGEVVSGMGT PLGFPQQDAA  240
ATFFIDGDLA GAGETTQSHM PFFGDMGVVS DHELRWDTLP PCANSTFSTT AGAMELWNPA  300
APNAAAPMLC REASDDLAAF FSSLDENNMV VY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-50115815169NO APICAL MERISTEM PROTEIN
1ut4_B1e-50115815169NO APICAL MERISTEM PROTEIN
1ut7_A1e-50115815169NO APICAL MERISTEM PROTEIN
1ut7_B1e-50115815169NO APICAL MERISTEM PROTEIN
4dul_A1e-50115815169NAC domain-containing protein 19
4dul_B1e-50115815169NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00439DAPTransfer from AT4G17980Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3689850.0AK368985.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv2083F05.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010235019.21e-146PREDICTED: NAC domain-containing protein 72-like
SwissprotA4VCM09e-70NAC45_ARATH; NAC domain-containing protein 45
TrEMBLM7YE720.0M7YE72_TRIUA; NAC domain-containing protein 78
STRINGMLOC_58950.30.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62093854
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17980.13e-78NAC domain containing protein 71